PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10027508m
Common NameCICLE_v10027508mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 227aa    MW: 24895.5 Da    PI: 6.534
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10027508mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.51.5e-5617112297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl+kyre+eg
  Ciclev10027508m  17 KEQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKIYLNKYRETEG 110
                      79******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  Ciclev10027508m 111 EK 112
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-5514140IPR009072Histone-fold
SuperFamilySSF471139.73E-4219131IPR009072Histone-fold
PfamPF008082.0E-272286IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-195068No hitNo description
PROSITE patternPS0068505369IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-196987No hitNo description
PRINTSPR006151.1E-1988106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
NQTSPIGSPT SGNISDKEQD RFLPIANVSR IMKKSLPANA KISKEAKETV QECVSEFISF  60
ITGEASDKCQ REKRKTINGD DLLWAMTTLG FENYVGPLKI YLNKYRETEG EKNSMARQED  120
QAANPNPSHA AAAEINKANN SFSSSDNKAD FQNFNMGFYS LGAQVAPNSN GEGTRVMGYG  180
ENLGVEAFNL SRIYDNRDGN GGNRSAMAAH YNYCLLKFSF SAFTYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4817107292Transcription factor HapC (Eurofung)
4g92_B4e-4817107292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428057.11e-169hypothetical protein CICLE_v10027508mg, partial
SwissprotO233107e-66NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLV4SKW91e-169V4SKW9_9R
STRINGPOPTR_0005s08510.19e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2056356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.17e-67nuclear factor Y, subunit B3